PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS578350.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 72aa    MW: 7668.73 Da    PI: 10.051
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS578350.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.64.4e-162322656
       G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56
                  +A+Pk+il+lm+v+g+t+e+v+SHLQkYRl+
  EcS578350.10  2 EAVPKKILDLMNVEGITRENVASHLQKYRLY 32
                  69***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015575.1E-14231IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-15236IPR009057Homeodomain-like
SuperFamilySSF466896.09E-9335IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
AEAVPKKILD LMNVEGITRE NVASHLQKYR LYLKRLNTNG ASQAAFGDFH ALAGSGRLSS  60
TSLSSYAAGG ML
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051666.11e-40PREDICTED: two-component response regulator ARR14-like
SwissprotA2X1N25e-19ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8055e-19ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A059CW163e-41A0A059CW16_EUCGR; Uncharacterized protein (Fragment)
STRINGVIT_11s0206g00060.t015e-24(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2799933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.12e-16response regulator 18